Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G196700.1.p
Common NameGLYMA_16G196700, LOC100784656
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 776aa    MW: 84753.3 Da    PI: 5.8833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G196700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
                          79999************************************************999 PP

                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          la++a++el+k+a+ +  +W kss    e +n de+ + f++  +      + +ea r +gvv + +  lve+l+d   qW+e++     
                          6899********************9999999**********99999********************************.*********** PP

                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a+t+ev+ssg      galq+m ae q+lsplvp R + f+R+++++ +g w++vdvSvd  +++++s++++ +++lpSg++i++++ng
                          ****************************************************************************************** PP

                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                           s++twveh  ++++++h+l+r+lv+sg+ +ga++w atl rqc 
                          ******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.96186146IPR001356Homeobox domain
SMARTSM003892.5E-1988150IPR001356Homeobox domain
PfamPF000461.9E-1989144IPR001356Homeobox domain
CDDcd000864.52E-1893146No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084843.495291528IPR002913START domain
SuperFamilySSF559611.17E-31293525No hitNo description
CDDcd088752.34E-107295523No hitNo description
SMARTSM002342.0E-39300525IPR002913START domain
PfamPF018524.7E-47301524IPR002913START domain
SuperFamilySSF559616.04E-17543747No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006599621.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7MIK70.0K7MIK7_SOYBN; Uncharacterized protein
STRINGGLYMA16G32130.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein